DPCstruct | MC15794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 127 ± 20 aa |
| Standard deviation of domain lengths | 19.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3AI27 | 49-185 | SESCHHNFEWVTVQEATAIADAVLAYECTNCGRVTDYMKEPNSAFAQFNKESITSIETAQKNAAVTLDTDIWNSFQGSVLSALSSRP… |
| A0A174W6K7 | 14-128 | LAYECTNCGRVTDYMKEPNSAFAQFNKESITSIETAQKNAAVTLDTDIWNSFQGSVLSALSSRPDITLVIKYRYEGKRYTVTIPAGS… |
| A0A3A9SJJ7 | 141-293 | None |
| A0A3A9SLV7 | 803-948 | None |
| A0A3A9T4I1 | 1-108 | None |
| A0A3D1Y7W7 | 170-307 | None |
| A0A3E2SW00 | 286-389 | None |
| A0A3E2T0I4 | 345-450 | None |
| R7MXP3 | 6-104 | None |
| A0A3A9IJR6 | 35-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.