DPCstruct | MC15793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 154 ± 16 aa |
| Standard deviation of domain lengths | 15.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J8V146 | 5-143 | PDYMIYSCLQWQDQNLRAMNQAAKQTFCVMHGDYLDDRFITALERAYLRGAMAPVKLIAYHEQYLDIILDSKVSSSSIPAIEAIWEV… |
| A0A226XCK3 | 1-128 | MHQLQFGRFLDFAIIWDEDHDDRVVDAILVMYLGGLLAPVRFIGERKGVLSVLLAPAAVQAWDDHAFQRYREDVADVCTSLEDPWTA… |
| A0A4T1ZPB4 | 8-173 | None |
| A0A560FB46 | 63-232 | None |
| A0A1G8SH59 | 3-157 | None |
| A0A1E4PZQ0 | 6-175 | None |
| R9VD11 | 8-145 | None |
| A0A5E7VLP7 | 13-167 | None |
| A0A3M4EVB6 | 1-141 | None |
| J8VGF6 | 2-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.