DPCstruct | MC15792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 209 ± 29 aa |
| Standard deviation of domain lengths | 29.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09850 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J8UXF6 | 392-623 | YPADPDFQLRGGYDNLMLDAAAPLFGLVIRLRTLDALPNIKEVHQQVRNQIENVREEMRQHGYEPAQLLAYSYGLCLFIDEAVMDRP… |
| A0A3M8RT05 | 65-211 | FKNLMLDAASPLFGLVIRLRTLDELTNIAYVHKTVQNQVSNIREEMRQHGYATAHLEVYSYALCLHLDEAVMSRPWGNNSCWSHEPL… |
| A0A2I8Q885 | 4-213 | None |
| A0A350KQ23 | 4-236 | None |
| A0A1T4VP82 | 11-226 | None |
| A0A485JIX0 | 9-198 | None |
| C6HYE0 | 1-210 | None |
| A0A3B0MKM6 | 4-188 | None |
| A0A379FGK7 | 3-186 | None |
| A0A7W9WTJ1 | 64-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.