DPCstruct | MC15791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 357 ± 87 aa |
| Standard deviation of domain lengths | 87.00 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 72.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.50 |
| Pfam Score | 74.28 |
| Assigned Pfam label(s) | CL0595- PF07253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8E7G9 | 11-302 | IQTIAHSFQLAIVSSEQSMVNISQILITLTNNFNVFKSNLLQLQNAFQSLVEGRISPFLIPKHDFSRTLHQIQSTLNKKYPGFYLTH… |
| A0A6I8UKK2 | 17-360 | EYVKYTGSIISRIQDNGVDFRDLLANRTSVIDSTFNVIRENVFNSNEISSLYFGGQADQLRALAGRIKQTKDAIRDAVFTALHGKVH… |
| K7H121 | 46-432 | None |
| E9HJP0 | 13-373 | None |
| E9HQB4 | 6-288 | None |
| E9I2A6 | 749-1209 | None |
| A0A0L7QK90 | 15-329 | None |
| A0A7J6YR64 | 109-476 | None |
| A0A162QDZ8 | 759-1193 | None |
| A0A7J6Z2L6 | 43-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.