DPCstruct | MC15790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 237 ± 26 aa |
| Standard deviation of domain lengths | 26.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523BRJ7 | 3-233 | LAVVIFQIFSYASSAAILGGAAVVSIRARRVNQLLLTSLSALSIVWLEGPYDWAIYVQFHPAFPRVPDWGPFGATWQGLPAMMPAGY… |
| A0A290XW67 | 4-257 | IYFWDGLSIVGSIVFVTWIVRKRIRDGELPPVAIVAMAWMLTAWQDPLVNALRPVYSYNSHFPNFGTWAEFIPGWVDNGGVNPQPIF… |
| B0T7D8 | 8-212 | None |
| A0A125PBU2 | 56-309 | None |
| A0A1I5WPI8 | 5-196 | None |
| A0A7M3LX12 | 139-395 | None |
| A0A2K9CAK1 | 25-259 | None |
| A0A2S8BQ50 | 59-319 | None |
| A0A522NRM1 | 158-411 | None |
| A0A522NYJ9 | 1-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.