DPCstruct | MC1579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 174 ± 47 aa |
| Standard deviation of domain lengths | 47.48 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.84 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF06996- PF05947 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379TX06 | 463-612 | QLCGTQQTPVRVRNLCRPSIPCYPPSENRFHWKLLSHLGSSFLWMMNNAEVLRNTLALYNWADSDVNRRRLNGILRVEHHRLEYWKR… |
| A0A6D0EJR0 | 23-173 | VSETPLTVRNLCKPTLPAYPPAEDRFHWRVMSHLGTRFLNMMSSADVLRGTLSLYNWRDDELNNRRLDAILDVRHHRIQRFEEGFLL… |
| A0A1I2UYN1 | 335-452 | None |
| A0A399I9Y7 | 761-922 | None |
| A0A850QR40 | 5-99 | None |
| A0A7X6QT63 | 44-243 | None |
| A0A4V1XRP7 | 550-768 | None |
| A0A251WN05 | 18-151 | None |
| A0A2D0JMY7 | 164-383 | None |
| A0A2N7VTT0 | 464-683 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.