DPCstruct | MC15789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 159 ± 10 aa |
| Standard deviation of domain lengths | 9.81 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438KWG8 | 55-203 | TRPQQTAIFQLSRLGLIHIQSCFPHLNHRLTTYQLIRRIIKPSLFDQGSFGLCGPAAFVITECAQDPVAFASFAVQLFETGSGTLKG… |
| A0A318HPL6 | 6-160 | QDAIKVVDEFSALSTGSVFGQISKVQFIKELKERICHPRSIVQSKNGTCGAAVLCKYVAEVNPVLFANMTIGLYTEGKFRNNGLKLI… |
| A0A7W6F4D9 | 18-191 | None |
| A0A377GNF8 | 133-279 | None |
| A0A538QW08 | 228-382 | None |
| A0A553DQ97 | 250-402 | None |
| A0A5C8PCE0 | 91-261 | None |
| A0A073CIJ0 | 8-156 | None |
| A0A7X7NIC6 | 598-753 | None |
| A0A2T1FCP8 | 23-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.