DPCstruct | MC15783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 12.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.34 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | CL0220- PF02179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2ZZC3 | 73-167 | VRKNVKKIMAIREQVNDIERSVSKTETVELIRNDPKQRLKVNENLMSLLFKLDSVKGVDSCVRDFRKSVIKKAIALQEMVDAIISGN… |
| A0A7N2LVJ7 | 1-119 | MKKITAIRREVDKVERWISREEALESMKQDPKERLRVNKTLMSLLYKLDLVRGINSGVRDCRKSVIKRAIALQEFLDTIVADGQTLT… |
| A0A7N2L7L2 | 56-175 | None |
| A0A1Q3DEV6 | 68-205 | None |
| A0A6A1UML3 | 61-182 | None |
| A0A6V7QXI9 | 83-191 | None |
| W1P231 | 65-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.