DPCstruct | MC15782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 91 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6SLU4 | 7-90 | AALLVLLLLVCAGAFSAAAAAAGASKGKGGSGRGGLPPCRDLATRGECSARSGCRWCRSEALDDMCFGATEAWRLPRQVFSCDP |
| A0A7N2LRJ7 | 6-88 | RILVSILVVFLLLQTLDATSSSIGRRPLARNKNRQIPPNCTHLVSESQCSQNPQCRWCKSQSLDDSCFARSEAWRLPLQVFSC |
| A0A2J6K4F0 | 1-86 | None |
| A0A6P4BMX8 | 6-86 | None |
| A0A078HXF3 | 4-77 | None |
| A0A6A4NQU4 | 45-152 | None |
| V7CRC0 | 7-83 | None |
| A0A803N2T9 | 1-100 | None |
| A0A7S0U4D5 | 26-123 | None |
| G7L7B1 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.