DPCstruct | MC15781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 6.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5F886 | 132-209 | YGDLFDAVPMRLRGRIDLMVSNPPYVAAPEVDSLPADVRREPKGALVAGERGTEVIERIGAEAARWLAPWGRLGVEIG |
| A0A7J6HD22 | 738-813 | RQGSWFEPLKDVEGELAGIISNPPYIPSSHISGLQAEVGRHEPRTALDGGISGMDDLLHLCNGAASMLKPGGFFAF |
| A0A2Z6MHJ3 | 124-200 | None |
| A0A7V7VPI0 | 146-205 | None |
| A0A6F8XUC7 | 344-423 | None |
| A0A849H9A0 | 59-135 | None |
| A0A7W1M0L6 | 53-126 | None |
| A0A7J0G962 | 1004-1081 | None |
| A0A7X7RU07 | 1-65 | None |
| A0A7R9AHQ4 | 569-635 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.