DPCstruct | MC1578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 109 ± 21 aa |
| Standard deviation of domain lengths | 21.26 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.90 |
| Pfam Score | 99.33 |
| Assigned Pfam label(s) | CL0061- PF02135 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379TVZ3 | 6-109 | MNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKALFGADYAN… |
| A0A444FJ73 | 10-118 | TPLSAVDPEIHDLIEHEKRRQSHGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEHIDAIENLCRSRALGAFRLDPAR… |
| A0A817RDL8 | 99-160 | None |
| A0A835JRZ9 | 57-165 | None |
| A0A4Y7L093 | 21-122 | None |
| A0A444XCF5 | 45-121 | None |
| A0A2M6YCI2 | 3-104 | None |
| A0A6A6L2D7 | 106-222 | None |
| A0A6J5VLQ7 | 74-195 | None |
| A0A2R6Q6I7 | 76-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.