DPCstruct | MC15779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 140 ± 16 aa |
| Standard deviation of domain lengths | 15.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 54.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452ZTM4 | 40-135 | MTVIDILTRVDAICQKYDKYDAEKLNGANVAGEDPFARLYGSVDAEISQCVEKAEAARQEKNRATVVALNAEIRRAKAKLLEEDLPK… |
| A0A7N2LHE3 | 22-175 | YEKYDVDKHKDKDPSVVSGGDDAFARLYGVVEADTDAAFQGGEPFAVKKIERERRRRKKSDAAANEKNGATVVALNAEIRLTKARLL… |
| A0A4S4DTD9 | 1-150 | None |
| I0Z9S0 | 1-129 | None |
| A0A6J0MRN4 | 2-115 | None |
| A0A1I9LQN3 | 1-150 | None |
| A0A7J7GKF0 | 27-176 | None |
| A0A803M7X5 | 1-145 | None |
| A0A2R6QP75 | 1-149 | None |
| A0A2Z7BR42 | 1-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.