DPCstruct | MC15778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 11.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A494T4T9 | 3-94 | ASPEFQELRRRLRSFVFPMTAFFLIWYVVYVLLSTYAVGFMSTPVWGNINVGLLLGLGQFVTTFAITGIYVKFANRELDPRAEALRN… |
| A0A6G6KEB0 | 4-104 | ETNPIPSGQWEKIAQHPGFAELKRAKLRFIIPATIFFMVYYMALPVLVGFFPELMKKPVWGKVNWAYLFALSQFVMTWVICGLYVRA… |
| A0A660LAD6 | 1-105 | None |
| A0A1B2HDM6 | 45-130 | None |
| A0A1V2P416 | 3-103 | None |
| A0A4U0SL46 | 21-127 | None |
| A0A0H3D100 | 22-131 | None |
| A0A536L818 | 2-80 | None |
| A0A2K8N4E3 | 18-115 | None |
| A0A2W4NIS1 | 39-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.