DPCstruct | MC15777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 295 ± 21 aa |
| Standard deviation of domain lengths | 21.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090TRX2 | 1-318 | MTIKRFSLTLLILIFSGCATYAGLNYDQLFGKPEVRERTVPVSSPESDFFLSEVKPIIDNRCVVCHACYDAPCQLKLSSVDGIDRGS… |
| A0A378PVW8 | 23-298 | VDSKEASFFLSDVKPIIDQRCVVCHACYDAPCQLKMSSVEGIDRGASKALVYHGTRLTASAPTRLFEDAQYTEQWRDFGFHPVLNER… |
| A7BV89 | 64-378 | None |
| A0A3A0C1Y4 | 245-535 | None |
| A0A558HUQ4 | 15-350 | None |
| A0A2D9W1X7 | 30-319 | None |
| A0A656GYS9 | 3-262 | None |
| A0A0C4WP69 | 1-279 | None |
| A0A0P9IZJ8 | 1-299 | None |
| A0A2H6G429 | 40-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.