DPCstruct | MC15776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 55.18 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0039- PF20979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5ICM9 | 132-212 | QDLKEEFVKDYIFPCLRAGAIYERKYLLGTSMARPLIAKAMVDVAKEVGADAVAHGCTGKGNDQVRFELTFFALNPKLNVV |
| A0A090TG18 | 1-71 | MVADYIFPTLKTGAYYEGKYLLGTSMARPIIAKAQVEVARKVGADALCHGCTGKGNDQVRFEGHLQLLPQT |
| A0A2M6YG27 | 68-147 | None |
| A0A4Q4UTB6 | 14-91 | None |
| A0A2P5DFV8 | 501-585 | None |
| A0A3B3D1F5 | 15-95 | None |
| A0A6A1QME8 | 40-115 | None |
| A0A0H1RNA7 | 62-141 | None |
| J1K3C4 | 2-67 | None |
| G5K590 | 61-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.