DPCstruct | MC15774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 3.98 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01933 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1V4A7 | 24-94 | VDELIEVPQRLYVDPAVPATKEAVVAIEQADLILLGPGSFLTSVMPSLLLKEIAQALKHTSARLVFITNLD |
| A0A090TEX0 | 1-80 | MDEMEQDLQRLDLEPVVPATKEAVDAILQADCIVLGPGSFLTSIMPPLLLAELSQAINSNTKAKVVFVENYHQSMARQEE |
| A0A645J5U8 | 8-79 | None |
| A0A2X1SSD6 | 153-220 | None |
| A0A7V6W757 | 1-64 | None |
| A0A0R2X4J4 | 30-97 | None |
| A0A484WPQ9 | 54-127 | None |
| A0A379WD12 | 1-75 | None |
| A0A6S6RX52 | 30-101 | None |
| A0A376JBL5 | 123-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.