DPCstruct | MC15773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 148 ± 36 aa |
| Standard deviation of domain lengths | 35.96 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.78 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | PF18416- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6C019 | 68-214 | LRAGVLQTDGTFKTEHSSYLNKIWTDSAPDRVALTTACRFSQWSDLYTVNAVGALPEGTTITCNLLNKSTGDLYQTVQCHVPTERLG… |
| A0A090TDC3 | 40-177 | ILAYWDVGDTAAAFYNVIDVQFEGTTPGIPGWTQAGTINPTMDLKEGDSVYTRVFDANGELPNLSTSITISSSEQGAATQWSHALAS… |
| A0A381EV65 | 637-759 | None |
| A0A7V8LX94 | 2-102 | None |
| A0A6B9G3W8 | 418-541 | None |
| A0A655ULV5 | 1-114 | None |
| A0A655X2P7 | 67-216 | None |
| A0A3Q9D5V9 | 6-139 | None |
| A0A379ICV8 | 234-356 | None |
| A0A522EGJ3 | 307-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.