DPCstruct | MC15772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 220 ± 28 aa |
| Standard deviation of domain lengths | 27.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2Y0P9 | 44-274 | MWSELVTPENVDSRIWPRTAAIAERFWSPQRVKEVNDMYRRLDAISLQLEELGLTHEKNYAMMLRRLANQEEIAPLKTLVDVIEPIK… |
| A0A090T9U2 | 237-459 | IWPRSYAIAERFWSSEELTDEASMYKRMRAIDNWSEISLGMRHHADSRVMMQRLANGADITPLLALARYTEPAQYYARNWEKWIQTE… |
| A0A3B9KRE5 | 95-339 | None |
| A0A2V7Y870 | 2-171 | None |
| A0A2V8SVY4 | 113-352 | None |
| A0A2D6LX55 | 21-233 | None |
| A0A228QI20 | 287-561 | None |
| F7VJC7 | 89-337 | None |
| A0A7S3ZI48 | 18-238 | None |
| A0A841HDP1 | 59-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.