DPCstruct | MC15770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Standard deviation of domain lengths | 4.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 95.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.99 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 76.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00719 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0M9Y5 | 48-102 | VVNEIPRFENAKFEISKDISLNPIKQDIKNEKLRFTKNMFPFKGYMWNYGAIPQT |
| A0A820GGE6 | 87-136 | MVVEVPRWTNAKMEINKQLKMNPLVQDVKNGKPRFVHNVFPYHGYLWNYG |
| A0A448WTT3 | 1-53 | None |
| A0A1S3SLE2 | 99-158 | None |
| A0A674IBK9 | 105-162 | None |
| S9WYJ5 | 32-90 | None |
| A0A7R9DE09 | 29-78 | None |
| A0A674HUJ7 | 221-278 | None |
| A0A3P8BGB1 | 7-65 | None |
| B0WXH5 | 115-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.