DPCstruct | MC15769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 259 |
|---|---|
| Mean domain length (aa) | 165 ± 40 aa |
| Standard deviation of domain lengths | 39.52 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.24 |
| Pfam Score | 89.69 |
| Assigned Pfam label(s) | CL0041- PF15734- CL0607- PF12606- PF18422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8JCM4 | 7-154 | CPTGTYSAADPTPTADRQCAPVTAVCPTGTYSAADPTPTADRLCAPVTAVCPTGTYSAADPTPTADRQCAPVTAVCPTGTYSAADPT… |
| A0A673MMG9 | 1-157 | GPSDYKSTVGECCPMCNIGSVVYHDCTGDFSTTCIPCSPGTFMSEPNGLYQCFPCRQCAESQGLYIQSKCTTVRDTVCDVLDGYRTK… |
| A0A6P8HCA8 | 64-208 | None |
| C3ZIH9 | 40-206 | None |
| A0A2B4SJK4 | 2-138 | None |
| A0A2B4SGJ8 | 55-209 | None |
| A0A6I8P8D9 | 164-373 | None |
| A0A2B4SF43 | 77-221 | None |
| B6VNV5 | 62-198 | None |
| W5MF94 | 102-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.