DPCstruct | MC15767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 5.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 62.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401Q2V4 | 65-123 | VMQKGYMWKKGHVRRNWNERWFVLKTSHIHYYVNEDLKEKKGEIQLDMDSTVEVLPDKE |
| A0A673LWU3 | 3-62 | VFQGYLWKKGHLRRNWTERWFCLKPGSLSYFTSEDCRDCKGVIEMDQNCCVEVRRSSLRL |
| A0A060XB13 | 94-155 | None |
| A0A4Z2HE07 | 5-66 | None |
| A0A4Z2IIZ2 | 126-188 | None |
| A0A674DNN4 | 216-272 | None |
| A0A060Z8C9 | 65-121 | None |
| A0A060Z3W7 | 70-134 | None |
| A0A6A4TD93 | 209-261 | None |
| A0A803YSG6 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.