DPCstruct | MC15764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 249 ± 28 aa |
| Standard deviation of domain lengths | 28.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1J3S9 | 10-244 | AGHDFNHIGELINASRFDWDSYETSWDFSRLPLFDDRIYAKSLQECIQNLRVEQDAIAEEQRQREILNNQIVADAYGVRDVVNCDVP… |
| K8B9V2 | 2-190 | RNIESHINASFLEKTGLTKQLESDVKEDDITLCCNKSFRYGINISAEEKEYRFSSDNLSQLISYIIGCMMGRYSLDREGLVYAHEGN… |
| A0A1A8XVE6 | 201-457 | None |
| H1D8U2 | 261-535 | None |
| A0A0C3IL85 | 2-259 | None |
| A0A3N2KLM4 | 1-295 | None |
| A0A7H4PQD7 | 1-213 | None |
| A0A827Z2Y6 | 466-726 | None |
| A0A7H9ZF82 | 612-867 | None |
| R6D4D8 | 1-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.