DPCstruct | MC15763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 469 ± 112 aa |
| Standard deviation of domain lengths | 112.25 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 12.92 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0023- PF04465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1J397 | 18-461 | SMLAAISATLRDDHTGRVGDIVPFDKLYDGIRDTIQSTANYRINQAENRLPEGITHDLGVRLLKVLLLVRHVEGFKATPRNLRILLT… |
| A0A7W1MY15 | 3-384 | GPNAEPVKIDAGKPLFGQRSLTRRLARTVFFGAAPTIGSAHKGLETQRVFLGTAIPGDVPGNFHSALAALADRATYFYSAGGRYWYD… |
| A0A6B1FBA9 | 13-355 | None |
| A0A397S6S4 | 364-963 | None |
| I3Y789 | 269-633 | None |
| A0A535ELP7 | 339-899 | None |
| A0A7C1J700 | 522-949 | None |
| A0A7K0AR51 | 377-734 | None |
| A0A2H6HS09 | 2-346 | None |
| A0A482Z4S3 | 6-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.