DPCstruct | MC1576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01977 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J9QZG4 | 151-263 | PCKENKLFGDAVDLTALPAPLIHAADGGRYIQTYGMHVVQSPDGAWTNWSIARAMVLDGRHLVGLVMAPQHIWQVQQMWKREGKKEL… |
| A0A379TUC0 | 3-105 | ENTVDGDAINLFDILPLFRLNDGDGGFYLDKACVVSRDPLDPENFGKQNVGIYRMEVKGKRKLGLQPVPMHDIALHLHKAEERGEDL… |
| A0A7Y4SS43 | 52-142 | None |
| A0A366S9U8 | 76-167 | None |
| A0A7H4MHS4 | 5-90 | None |
| A0A3B9HKT9 | 133-223 | None |
| A0A1F3YWS1 | 64-182 | None |
| A0A7C1SY86 | 134-226 | None |
| A0A2V7KFM3 | 40-133 | None |
| A0A3R8PKP6 | 72-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.