DPCstruct | MC15757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1535 |
|---|---|
| Mean domain length (aa) | 310 ± 79 aa |
| Standard deviation of domain lengths | 79.35 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.38 |
| Mean intra-cluster sequence similarity (%) | 13.56 |
| Pfam Score | 99.12 |
| Assigned Pfam label(s) | CL0020- CL0056- CL0077- PF11658- PF11893 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Y9NUF1 | 5-363 | DLGVYGEPSRETPNLDRMAAEGMLFPNFYTANPLCSPSRAALLTGRLPIRSGFYTTNGHARNAYTPQEIVGGIPDSELLLPELLKEA… |
| A0A800AKF6 | 165-498 | RKPEKPNVLLISIDTLRADHLSCYGYHRRTSPNIDKLAQEGILFKNTFSQCSWTIPSHGSIFTSKLPHRHGGTIDTAPGGTWHPLPF… |
| A0A1W1XDV9 | 13-306 | None |
| A0A2D5WIA6 | 685-1031 | None |
| A0A2P9I6G2 | 6-330 | None |
| R5LKQ5 | 27-230 | None |
| A0A2E1H454 | 155-407 | None |
| A0A7C8GIY7 | 3-203 | None |
| A0A5B7DD06 | 11-443 | None |
| A0A350IXB5 | 267-583 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.