DPCstruct | MC15752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 11.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7CWV1 | 3-100 | AAVRALDLNDRRMAIGPDEGLALRVVKVAEECGEASAALIGLRGQNPRKSRGSEQELIDELLDVALSALVAAASTTGDWAARFTAHV… |
| L8EY50 | 76-183 | DAAEPADMWPTIRDFVAWLDDANGRDEHEKTLRILKITEEAGEVAQAWIGMTGQNPRKGVTHTREDVADELCDVAITALTALASVVD… |
| A0A2R9UCQ3 | 3-105 | None |
| A0A100JFT1 | 74-183 | None |
| A0A1D7VXA7 | 3-111 | None |
| A0A6I7YWU3 | 6-104 | None |
| A0A419YSB7 | 31-131 | None |
| A0A2A3I394 | 263-371 | None |
| A0A6B2VRC8 | 2-76 | None |
| A0A1B9ER02 | 4-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.