DPCstruct | MC15751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 108 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8ETD0 | 33-127 | IAAILRTVHTGTHIYPRDKLPEARLCGFLFLAPDRLRLYLDTEEAPSGMTAADVRPGGAPTALLAALPSLLDEQRLTTTDADDPHCA… |
| A0A7L4Z7Q4 | 10-100 | VFEHLPGIVRALVADHTPDLPVFKGLVVTGDDRMRLYLTAPDGSLTYGADVIISHAGPGLLAGIGSGYLENEYEQKPTDDPLCDVVV… |
| A0A344TZQ5 | 3-110 | None |
| A0A0H1AZX9 | 1-118 | None |
| A0A646KKE3 | 43-151 | None |
| A0A7R8RYV3 | 1-81 | None |
| A0A250VNQ0 | 38-146 | None |
| A0A4D4MAX3 | 2-111 | None |
| A0A7W9DQ62 | 1-99 | None |
| A0A5J6HJW5 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.