DPCstruct | MC15750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 9.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8EGV3 | 2-113 | APREGGIVGVTLRVPQGVRRSFTKTTVCSLCLTGHPGSGVSLLAARKAGALGRQGNTVGTYICADLACSLYVRGKKKSELAGRHEES… |
| A0A1Q8JPL8 | 5-111 | PTAEGPAGVVLRAATGTARAAAMCALCRTTHSVGGVALFAAPRRGAKGRQGDTVGTYICTDLACAEHVRVETATAVLKPTPGTTVDE… |
| A0A5F0G6E0 | 55-160 | None |
| A0A1Z9ASC0 | 88-179 | None |
| A0A7G7C3Z1 | 110-214 | None |
| A0A239CFX9 | 58-156 | None |
| A0A5Q2MFW9 | 67-162 | None |
| A0A2D5TCJ3 | 113-205 | None |
| A0A2W1WGJ3 | 256-361 | None |
| A0A3B9NU69 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.