DPCstruct | MC1575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 159 ± 40 aa |
| Standard deviation of domain lengths | 40.47 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 82.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 45.90 |
| Pfam Score | 87.88 |
| Assigned Pfam label(s) | CL0328- PF16327 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4YU23 | 1-215 | NYWMTIHPPTLFLGFASTIVPFAYAIAGLWTREHKEWLKPALSWSLFSGAILGTGILMGGAWAYEALSFAGYWAWDPVENSSLVPWI… |
| A0A379TSK0 | 2-137 | FLTLGIVLGSAWAYYELGWGGWWFWDPVENASFMPWLAGTALLHSLAVTEQRAGFKAWTLLLSICAFSLCLLGTFLVRSGVLVSVHA… |
| A0A4Y7KUA8 | 162-282 | None |
| A0A0D6QSE8 | 344-466 | None |
| A0A3S0JI32 | 181-369 | None |
| A0A509D0M7 | 69-212 | None |
| A0A3P6F0B3 | 16-126 | None |
| A0A7C7Q745 | 4-168 | None |
| M1FPL3 | 21-141 | None |
| A0A059CTK8 | 83-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.