DPCstruct | MC15747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 151 ± 26 aa |
| Standard deviation of domain lengths | 26.28 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.75 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF01131- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0F317 | 67-202 | MPCFLCPHPTCPHSVIVQGVCACPECNGTLVLDPVSAPKWRLYCNTCNCLVFLSEGAHRISTTKEQCSECDSTIIEVHFNKKTTPLK… |
| A0A803R7G1 | 17-138 | TQGVCACPECSGTLVLDPVSAPKWRLHCNSCNCLIFLPQGAHRISTTQDKCLDCNSTIIEVDFNKKTTPLEDGTTLYAGCILCDEFL… |
| J9E791 | 255-400 | None |
| A0A7R9UBJ8 | 2-133 | None |
| A0A086K1P7 | 1-145 | None |
| A0A7J0E6B2 | 255-391 | None |
| A0A1D1YH00 | 3-151 | None |
| A0A812JUV4 | 1075-1211 | None |
| A0A3Q0J4U6 | 404-544 | None |
| A0A7G2BZ95 | 273-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.