DPCstruct | MC15746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 266 |
|---|---|
| Mean domain length (aa) | 67 ± 13 aa |
| Standard deviation of domain lengths | 13.31 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.92 |
| Pfam Score | 94.97 |
| Assigned Pfam label(s) | PF00082- CL0010- CL0229- CL0708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9LBX7 | 5-59 | NDPVYCLCRMPYDETRFMIECDVCKDWFHGGCVGVQEHQAADIEIYHCPSCALKH |
| A0A803QYW9 | 10-73 | ESGEEEEEDDEQGATCGACGDNYGADEFWICCDVCERWFHGKCVKITPAKAEHIKQYKCPGCSS |
| A0A6J8DET1 | 103-172 | None |
| A0A7M3VJ84 | 210-294 | None |
| A0A7S2JNN8 | 49-106 | None |
| A0A1V8SEX1 | 559-609 | None |
| A0A6S7G9P8 | 1-50 | None |
| A0A6S7GMZ7 | 115-164 | None |
| K8F0Z9 | 184-247 | None |
| A0A7R9PUV7 | 20-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.