DPCstruct | MC15742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 203 ± 24 aa |
| Standard deviation of domain lengths | 23.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378I6J8 | 556-741 | LLEKDRITIQEFKALNTKDSEHLAIKGVYKLFKNNKITYQEFKELTDKDCERLKEQTIFALLYDNKITFQEFKALNDTNCKRLKNLN… |
| A0A6I5YD37 | 1-169 | MILQRYIDRGYLTTAKAEQLELDSFQSDVLNSETISQLIFSDFISVDEVLQLSLREQSNLKLHSICRLITSGLITIKDALAFAAKQR… |
| K2AYE0 | 209-439 | None |
| A0A7S3LT41 | 23-214 | None |
| A0A1G0J4D3 | 212-446 | None |
| A0A378JN70 | 9-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.