DPCstruct | MC1574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 161 ± 16 aa |
| Standard deviation of domain lengths | 16.27 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5PG74 | 2-123 | YMIRLNQNRQARKALTDNSAPLRTLTASERQCINNLSGLEGHVTSSDVYSLQGSYSSHGITTNGNTVMHDAINDVLVYFPYDAESFL… |
| A0A379TS95 | 3-182 | TILIFIAALLACSLLAVWRFRVKSRRGSLPWISAFQDAQTRKLLPEERSAVENYLDNLSQIQQVPGPTGASAAPISLTLNAESNSVV… |
| A0A1G6XCB0 | 2-154 | None |
| A0A7H4M8W1 | 1-176 | None |
| A0A3C0GQL7 | 1-144 | None |
| A0A3L0WZM2 | 5-144 | None |
| A0A066RSI3 | 1-143 | None |
| A0A376S1E9 | 1-178 | None |
| A0A1C4B9W4 | 1-168 | None |
| A0A5B8RCQ7 | 2-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.