DPCstruct | MC15739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 318 ± 17 aa |
| Standard deviation of domain lengths | 16.75 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2E028 | 1-332 | MITLPASDGMLSTYSLKSTELVAMENIKESILSIALKNGKDFYISEFVKHLLYTGSLFKEQGKDSDEYKKLTELLEKSIKTLGFEGK… |
| A0A5E4PJC7 | 351-662 | LHDLEKRHPNVAVITLPADKGMMDKHLLEDHHQSIRVQDAIDDILAIANGTSPRDIKDFHISDDIKQLLYGTDEYSEHGYNTVTENT… |
| A0A1G0H6Y3 | 427-765 | None |
| A0A0Q9YB22 | 265-555 | None |
| A0A5E4PH00 | 537-853 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.