DPCstruct | MC15733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 120 ± 9 aa |
| Standard deviation of domain lengths | 8.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K5UTV4 | 86-209 | FMSDGSDSEDSAYPAPSHPNTSPRQQPGASSEASTPCGCGLLQAMHEQLTSGHFPTTGGEYLEVIFIHREVFSAFPQGHLECAIAFC… |
| A0A409X9R6 | 1-119 | MSDDPSYQHLHSNTTSDNSTTSPSTEQRKSYGCAYLQVVRSQMEDYPTTNGEYLDAIFTHREILYSYPAGHYECARAFSEIAYMLEK… |
| A0A067PDH7 | 1-112 | None |
| S7QC81 | 55-175 | None |
| A0A4R0R565 | 75-191 | None |
| A0A4S4N289 | 4-112 | None |
| A0A4Y7PDE7 | 49-160 | None |
| A0A067NJV5 | 43-181 | None |
| A0A165DPJ3 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.