DPCstruct | MC15732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 233 ± 27 aa |
| Standard deviation of domain lengths | 27.16 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A409X500 | 2-239 | ESISAPPNAGVRPLAWQSLTFNPVGLYDLCRRLGFPSNPAIFSSFRQRFDTADVAWFTPGLASLPCNEIGEDDFYPDFLDLRSNTPR… |
| S8FXD2 | 23-297 | ATLRFCPTGLTRLAQVLDRAVLPGSRFAARLEAADYAYFVAGSHQDGTHRAGMNNFHPLFNQARDGTGTGVLGRRTRTLFRENLQAL… |
| A0A0C9YC28 | 10-261 | None |
| A0A0C9YWQ9 | 16-198 | None |
| A0A4Q2DAK4 | 7-229 | None |
| A0A5C2SVY2 | 3-252 | None |
| A0A5C2TA67 | 3-225 | None |
| A0A067PY47 | 16-244 | None |
| A0A4Y9Z6E6 | 5-241 | None |
| A0A1C7M7F7 | 86-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.