DPCstruct | MC15729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 83 ± 11 aa |
| Standard deviation of domain lengths | 10.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A409W308 | 32-104 | SLTSVRFAPFQDILTAGHSAGLSSVLVPGSGEPKFDSREADPFENKKARSEREVKALLDKIQPDMITLDPEMV |
| A0A402G1N0 | 124-211 | AHALRFCPFEDVLGVGHEEGFASLLVPGAGEPNFDAMEINPFRSRKQRQEWEVKALLEKIPSELISLDPGQLGTVDAVSLELQQKERT |
| A0A183NPR5 | 34-125 | None |
| A0A183WRL4 | 9-81 | None |
| R7U6R1 | 51-156 | None |
| A0A5N5HQ10 | 132-214 | None |
| A0A433Q4C2 | 1-85 | None |
| A0A146IGH0 | 380-463 | None |
| J4GB09 | 101-169 | None |
| A0A7S3DYL9 | 18-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.