DPCstruct | MC15726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 196 ± 33 aa |
| Standard deviation of domain lengths | 32.87 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF05485- PF21788- PF02466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7UKI5 | 7-196 | NDGAATTSDLPLNAAPVSALSTFNKLFESPECVLLPSAAWGFHRLQVDDLCNLVFSELRCVQDPQCAGDTTRMSHMVTVKLIDIDQD… |
| E2AI06 | 16-166 | FEDFLEVCTEVSIPHGWSCLVTSKGHGTTVVYLYMGITKDGLPFVEKQGFIRSDMVLHCAVANREIDPLMHNLVKERKMRNLLDIEI… |
| A0A7M5WXF1 | 3-165 | None |
| E9FYV6 | 63-271 | None |
| A0A2B4SQK1 | 245-479 | None |
| A0A6S7GYP6 | 1-181 | None |
| A0A3S1BA36 | 17-220 | None |
| A0A482ZQQ3 | 3-135 | None |
| A0A498NZT2 | 271-453 | None |
| A0A482ZK25 | 15-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.