DPCstruct | MC15724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 98 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 36.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09791 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0JKB9 | 3-84 | LRGLAGARRGGDTGDPPAAPPVPPPPTHCCGTGCPNCVWVGYVEELLQRHRDGGARALAAVEQLVEDENIKMILRMEIRLRA |
| A0A6P3CYU9 | 1-104 | MHAKTLSKLLADRCGTMRLRRFSQPPSRRSGESDDSTDTEKPPTPPGDEDCCKSGCSNCVWLEYAEALVDYYKDGGAKAQEAIAKIP… |
| A0A1S3GKS4 | 1-75 | None |
| A0A5C6PU12 | 30-134 | None |
| A0A6J8AT42 | 46-154 | None |
| A0A5J4N8Y7 | 7-119 | None |
| A0A182K3B7 | 71-163 | None |
| A0A7M7LTZ0 | 115-227 | None |
| A0A0K2URP2 | 2-90 | None |
| A0A0P4WFE9 | 20-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.