DPCstruct | MC15722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Standard deviation of domain lengths | 11.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9U5W6 | 1-154 | MPEDQTEYDYFSPYPNEGPDHSPDCTRCAEARPELEKIRDFALAQKERFADQALHPYVAGKTSLHRSNCSTMEDLAQQGRPLSWDEE… |
| A0A1H2DKJ8 | 145-270 | CPVCRTHRSGFDSALDVADIRWARYTEPEKYPFIAGSRGLHEVGCSVVRREMPKNYARPAGATYTSELRRHAHRPEHLGYRSPLEES… |
| A0A3G2JQF2 | 1-127 | None |
| A0A386ZLK9 | 2-114 | None |
| A0A2U3GU68 | 67-192 | None |
| D6KEE1 | 112-236 | None |
| A0A101RNJ8 | 101-226 | None |
| A0A7K2M624 | 28-163 | None |
| A0A3N6BPH0 | 2-110 | None |
| A0A1M7N160 | 80-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.