DPCstruct | MC15720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 103 ± 8 aa |
| Standard deviation of domain lengths | 7.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0GL33 | 1-114 | MVETIEIGPAPCDEACAQVGDMRYLERSRAECTAFINQIRRTLGEPPDGASLFIKSSAHDFGTYWEVVVKVTGGLSADAREAAIAYA… |
| A0A2E7QUA7 | 1-116 | MLDSLYIGSTAPYFEKCVLVGQPGFDFRARLEGQLFIDQIQAYYGKPDGSGELVVMPNNHDMGTYYSLEYRYDQSDHKALDYGIMVE… |
| A0A375JDF9 | 5-102 | None |
| A0A158S6H3 | 1-103 | None |
| A0A1M3D7U5 | 1-94 | None |
| A0A2N3DRX4 | 1-95 | None |
| A0A3C2EFK6 | 31-138 | None |
| A0A6H2A224 | 4-107 | None |
| A0A6P3APZ3 | 2-117 | None |
| A0A3C1Z062 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.