DPCstruct | MC1572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 178 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0167- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H3DJB9 | 1-163 | MQKILPIKCPKCNNKDSFYRYGKDRDGYQKYLCRKCNHQFAPDRPTSKKVPKYPRCPVCGKATFLHHDYKYYSNYRCCDKKCNHSMF… |
| A0A1Y4MGS4 | 24-216 | FMGVCPFCGAPKEYIYDNNSGKGQFQCKACKNTFTIKTSPSGASGIYCPYCNTKLVLKHDRKGFLVFACSSKKCEHYKANKKLLSGG… |
| A0A6C2U869 | 105-294 | None |
| A0A1E3G3X5 | 2-168 | None |
| A0A1I3AXJ5 | 12-190 | None |
| B9E1S2 | 94-279 | None |
| A0A2X3IEW4 | 1-161 | None |
| A0A139D1T4 | 68-237 | None |
| E2NVT6 | 135-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.