DPCstruct | MC15719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 171 ± 26 aa |
| Standard deviation of domain lengths | 25.55 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 15.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D7PTT6 | 1-143 | MTADEYIGQRVNQFADWYDKKAVSAKSAYLRLKTASVVGALIVPISANVSFAAYDAYRTGVITVLSLLVSISVALDGVYHFGDQWKN… |
| A0A2E1AEX6 | 79-254 | PPPILIDADAKTSERFYMEHRWYGQWKYYDERAEQNKGRYLLLQRIIVIGSVSVPVLISVGPSIQAGFESVGDSARLILDMITIISS… |
| A0A6L9J0T4 | 21-203 | None |
| A0A6B3NAQ5 | 10-205 | None |
| A0A1C4I2L0 | 97-235 | None |
| A0A7S2F3Q7 | 264-454 | None |
| A0A4R8CZB9 | 30-179 | None |
| A0A257JXY1 | 2-158 | None |
| A0A2V2UDE1 | 33-187 | None |
| A0A1E5QKY5 | 1-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.