DPCstruct | MC15717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 74 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09907 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9CRR4 | 11-80 | TSLKAWYKITKAAKWEHLLDLRQTFPSADSVGTCIVFNIHGNKCRLITRINFKWQLVYTLHVLDHAEYDN |
| D4ZY77 | 8-71 | VKSGKFNSFVELRSEFPSADQVDNLTVFNIGGNKVRLIAAIHYNRQKLYIRAVLTHAEYDQGKW |
| A0A4R5CSG4 | 1-50 | None |
| A0A3S9K1A6 | 3-64 | None |
| A0A0C2M098 | 48-117 | None |
| A0A7X2RSW4 | 4-59 | None |
| A0A1K1QQL5 | 29-112 | None |
| A0A7Y8R8G1 | 28-113 | None |
| A0A2V9A9N9 | 11-76 | None |
| A0A2K8U6B3 | 2-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.