DPCstruct | MC15716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 149 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U7QCR0 | 4-130 | LQPTQKTSPIVINSQPLEDETDNTAIAQELCNQIYQTVFPNDENIPEVNNHAQLKRLIPKLKKHLNTQHIALILYQCEPNTDLISFC… |
| D4ZVE2 | 15-151 | LLPQILNQAIQTHPLNCQPICIDRSRFSDPSNPALPIYTTLKKAGCPASPDGKPGTIAELQAYCEDDLSDHPIALILYEEPTDPPPQ… |
| A0A1T4ZHF4 | 6-117 | None |
| A0A354WH10 | 739-880 | None |
| A0A3C0NC62 | 239-424 | None |
| K1X616 | 339-489 | None |
| A0A2Z5X690 | 300-451 | None |
| A0A2T1F4L7 | 412-563 | None |
| A0A7C3VGB0 | 20-175 | None |
| A0A6H9G792 | 75-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.