DPCstruct | MC15714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 110 ± 10 aa |
| Standard deviation of domain lengths | 10.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6L8N6 | 135-232 | QAQAIGKAASDFIQEELKMDYVYDYMFHLLNMYAKLLKFEPRVTQGAVELCSEVMACPADGLERKFMTESLVKSPSVTGPCTMPPAY… |
| A0A328DDK8 | 1-97 | MEYVYDYMFGVLSEYAKLLTYKPTKPPQAVELCTEGIACELKGLEKEFMLETLVKGPSLKAPCTMPPPFDPATLHSIVDARESAMKQ… |
| A0A287UD32 | 2-119 | None |
| A0A0B0MZG7 | 10-128 | None |
| A0A4S4E4S7 | 18-141 | None |
| A0A6P6G852 | 237-340 | None |
| A0A0D3GVF4 | 152-265 | None |
| A0A834HGX8 | 83-192 | None |
| A0A087GZM3 | 208-332 | None |
| A0A0R0G205 | 167-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.