DPCstruct | MC15712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 143 ± 27 aa |
| Standard deviation of domain lengths | 26.86 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834HEB7 | 43-177 | AKRDKVVAILLLFGLPKPIIGATLAHEMGHALIRLQGWTFILERKVEEGICEAIAYEWLKYTIPNCDPSYTQNEAAIASYNQKGAEI… |
| A0A4R0GPH1 | 135-240 | ATGITVCTGMPRMHFGSTVAHESMHVWIRQRDFPELPTAVEEGLCELTADEWLRRQPDPRAALVRQGMASSPDPVYGEGFRAARAAL… |
| A0A7J7GSK3 | 613-765 | None |
| A0A7S0FAW4 | 11-158 | None |
| A0A835U3D1 | 78-233 | None |
| B9FRV1 | 729-878 | None |
| A0A6J5VMA8 | 371-496 | None |
| A0A7S3BHA8 | 25-181 | None |
| A0A6A2XQ90 | 229-357 | None |
| A0A0E0BUT6 | 457-618 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.