DPCstruct | MC15711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 224 ± 35 aa |
| Standard deviation of domain lengths | 35.05 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834H0C5 | 73-310 | SEDDKLVEYDALLLDRFLDILQDLHGEGIRQTVQDCYELSAEYARKVDPQKLEELGSVLTSLDAGDSIVVAKSFTHMLNLANLAEEV… |
| A0A287LMB6 | 23-285 | KLSEDDKLVEYDALLIERFLGILQGLQGDKIRETVQECYELAAEYERTLDPKQLDEIGNLLARLDPEDSIVTAKSLSHMLILANLAE… |
| A0A6M0F413 | 6-298 | None |
| A0A1K2FCI2 | 19-230 | None |
| U1PTE3 | 7-254 | None |
| Q74J38 | 12-248 | None |
| A0A0D3ADJ4 | 1-214 | None |
| A0A1L6FCW9 | 5-236 | None |
| A0A447PRF7 | 4-180 | None |
| A0A5J5AQ85 | 14-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.