DPCstruct | MC1571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 10.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12151 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0JYL1 | 2-112 | ATFKVNIPAGPIWSQQDANEKAPLVAAAHQGKWTGQWNTVVDSQMSVVELELNVKNGGKNEYKTNVLAGPLWSNDEAQKVGSVIAAS… |
| U7GMN4 | 81-179 | AYNVEAGPIWNNGDAQAKCPRVCSGLGANWNGQWHTTIQGQMSVCSCEKSSPGRSVEAGPIWNNADAQGKCPGICFGNGLSWSGQWR… |
| A0A858WUU5 | 7-126 | None |
| A0A6S6U5A2 | 26-127 | None |
| A0A7Z7Z431 | 2-101 | None |
| A0A7X9ZPX2 | 215-327 | None |
| A0A7W2GVJ9 | 88-198 | None |
| A9G5N8 | 56-157 | None |
| A0A6C0ALX9 | 8-143 | None |
| A0A6H5JPS5 | 4-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.