DPCstruct | MC15700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 109 ± 20 aa |
| Standard deviation of domain lengths | 19.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09864 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6MBQ2 | 5-80 | TDDIIETEATDANGKILYLIFNNTKGNVTIDFEGDIAVLKSERTGSGFWYKNKTYNLRGKGNHMTMKKDGVVVFEN |
| A0A7X5FBE5 | 163-267 | LDSQAMNPEEITAPSRGKKVSYQCDEGNKFMVSFGEYVSGDSIMKLQPEQVMFSDTQTRTATVMNRTVAASGEKYQSDGGMIFWSKG… |
| S9R0V5 | 4-102 | None |
| A0A7X6NSK7 | 2-91 | None |
| A0A847PK29 | 27-113 | None |
| A0A6N3U7G3 | 1-118 | None |
| A0A7Y8MI55 | 2-85 | None |
| A0A7H1NUQ1 | 11-136 | None |
| A0A5C1QDK9 | 14-118 | None |
| A0A554I722 | 24-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.